DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycbeta100B and Adcy6

DIOPT Version :9

Sequence 1:NP_524603.2 Gene:Gycbeta100B / 43682 FlyBaseID:FBgn0013973 Length:787 Species:Drosophila melanogaster
Sequence 2:XP_006520366.3 Gene:Adcy6 / 11512 MGIID:87917 Length:1254 Species:Mus musculus


Alignment Length:291 Identity:100/291 - (34%)
Similarity:154/291 - (52%) Gaps:30/291 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   449 YISDVPLHDAARDLVLLSEKFEAEYKLTKNLEMLTDKLQQTFRDLESEKQK--TDRLLYSVLPKS 511
            |::.|.|...|..|.|.:::.|:    |..|:.|. |||.|....|.|:.:  ..|||:::|||.
Mouse   982 YMTPVILLVFALALYLHAQQVES----TARLDFLW-KLQATGEKEEMEELQAYNRRLLHNILPKD 1041

  Fly   512 V-ANELRHQRPVPPKRYDS---VTLMFSGIVGFGQYCAANTDPDGAMKIVKMLNELYTVFDALTD 572
            | |:.|..:|......|.|   |.:||:.|..|.::.......:..::.:::|||:...||.:..
Mouse  1042 VAAHFLARERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIIS 1106

  Fly   573 SKRNLNVYKVETVGDKYMAVSGLPDHCED-----HAKCMARVALDMMDMAKNVKMGS-NPVQITI 631
            .:|...:.|::|:|..|||.|||.....|     |...:|..|:.:|:..|::...| |..|:.|
Mouse  1107 EERFRQLEKIKTIGSTYMAASGLNASTYDQVGRSHITALADYAMRLMEQMKHINEHSFNNFQMKI 1171

  Fly   632 GIHSGEVVTGVIGNRVPRYCLFGNTVNLTSRTETTGVPGRINVSEETYRLLCMAINQDDSFHLEY 696
            |::.|.||.||||.|.|:|.::|||||::||.::||||.||.|:.:.|::|..     ..:.||.
Mouse  1172 GLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAA-----KGYQLEC 1231

  Fly   697 RGPVIMKGKPTPMDCWFLTRATSSILGGTSS 727
            ||.|.:||| ..|..:||.       ||.||
Mouse  1232 RGVVKVKGK-GEMTTYFLN-------GGPSS 1254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycbeta100BNP_524603.2 HNOB 2..164 CDD:285002
HNOBA 326..516 CDD:285003 24/69 (35%)
CYCc 496..688 CDD:214485 70/203 (34%)
Guanylate_cyc 522..714 CDD:278633 68/200 (34%)
Adcy6XP_006520366.3 AC_N 83..454 CDD:318454
Guanylate_cyc 456..640 CDD:306677
DUF1053 668..754 CDD:368844
Guanylate_cyc 1056..1250 CDD:306677 70/206 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.