DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycbeta100B and ADCY2

DIOPT Version :9

Sequence 1:NP_524603.2 Gene:Gycbeta100B / 43682 FlyBaseID:FBgn0013973 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_065433.2 Gene:ADCY2 / 108 HGNCID:233 Length:1091 Species:Homo sapiens


Alignment Length:223 Identity:75/223 - (33%)
Similarity:123/223 - (55%) Gaps:37/223 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   486 LQQTFRD----------LESEKQKTDRLLYSVLPKSVANELRH---QRPVPP------------- 524
            ||||::|          ||.||::.:|||.|:||..:|.|::.   ||...|             
Human   216 LQQTYQDTCNCIKSRIKLEFEKRQQERLLLSLLPAHIAMEMKAEIIQRLQGPKAGQMENTNNFHN 280

  Fly   525 ---KRYDSVTLMFSGIVGFGQYCAANTDPDGAMKIVKMLNELYTVFDALTDSKRNLNVYKVETVG 586
               ||:.:|:::::.||||.: .|::..|.   ::|.|||||:..||.:  :|.| ...:::.:|
Human   281 LYVKRHTNVSILYADIVGFTR-LASDCSPG---ELVHMLNELFGKFDQI--AKEN-ECMRIKILG 338

  Fly   587 DKYMAVSGLPDHCEDHAKCMARVALDMMDMAKNVKMGSN-PVQITIGIHSGEVVTGVIGNRVPRY 650
            |.|..|||||....:|||...::.|||.:..|.|:..:. .:.:.:|:|||.|:.||||.:..:|
Human   339 DCYYCVSGLPISLPNHAKNCVKMGLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQY 403

  Fly   651 CLFGNTVNLTSRTETTGVPGRINVSEET 678
            .::.:.|.|.:..|..|||||:::|..|
Human   404 DVWSHDVTLANHMEAGGVPGRVHISSVT 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycbeta100BNP_524603.2 HNOB 2..164 CDD:285002
HNOBA 326..516 CDD:285003 16/39 (41%)
CYCc 496..688 CDD:214485 68/203 (33%)
Guanylate_cyc 522..714 CDD:278633 56/174 (32%)
ADCY2NP_065433.2 AC_N <33..260 CDD:292831 17/43 (40%)
CYCc 236..439 CDD:214485 68/203 (33%)
Guanylate_cyc 281..465 CDD:278633 55/158 (35%)
DUF1053 495..599 CDD:283888
CYCc 848..1056 CDD:214485
Guanylate_cyc 878..1077 CDD:278633
Interaction with GNAS. /evidence=ECO:0000250|UniProtKB:P26769 905..922
Interaction with GNAS. /evidence=ECO:0000250|UniProtKB:P26769 990..993
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.