DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycbeta100B and adcy1

DIOPT Version :9

Sequence 1:NP_524603.2 Gene:Gycbeta100B / 43682 FlyBaseID:FBgn0013973 Length:787 Species:Drosophila melanogaster
Sequence 2:XP_002933461.1 Gene:adcy1 / 100492373 XenbaseID:XB-GENE-950909 Length:1122 Species:Xenopus tropicalis


Alignment Length:211 Identity:70/211 - (33%)
Similarity:119/211 - (56%) Gaps:22/211 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   482 LTDKLQQTFRDLESEKQKTDRLLYSVLPKSVANELRHQRPVPP---------KRYDSVTLMFSGI 537
            :.|:|:     ||.|.:|.:|||.|:||::||.|::.....||         :|:|:|:::|:.|
 Frog   240 IEDRLR-----LEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERIFHKIYIQRHDNVSILFADI 299

  Fly   538 VGFGQYCAANTDPDGAMKIVKMLNELYTVFDALTDSKRNLNVYKVETVGDKYMAVSGLPDHCEDH 602
            |||....:..|    |.::||:||||:..||.|....   :..:::.:||.|..||||.....||
 Frog   300 VGFTSLASQCT----AQELVKLLNELFGKFDELATEN---HCRRIKILGDCYYCVSGLTQPKTDH 357

  Fly   603 AKCMARVALDMMDMAKNVKMGSN-PVQITIGIHSGEVVTGVIGNRVPRYCLFGNTVNLTSRTETT 666
            |.|...:.|||:|...:|...:. .:.:.:|:|:|.|:.||:|.|..:|.::.|.|.|.:..|..
 Frog   358 AHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANVMEAG 422

  Fly   667 GVPGRINVSEETYRLL 682
            |:||::::::.|...|
 Frog   423 GLPGKVHITKNTLECL 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycbeta100BNP_524603.2 HNOB 2..164 CDD:285002
HNOBA 326..516 CDD:285003 14/33 (42%)
CYCc 496..688 CDD:214485 66/197 (34%)
Guanylate_cyc 522..714 CDD:278633 55/171 (32%)
adcy1XP_002933461.1 AC_N <37..282 CDD:292831 17/46 (37%)
CYCc 248..443 CDD:214485 66/198 (33%)
Guanylate_cyc 284..466 CDD:278633 53/162 (33%)
CYCc 817..1028 CDD:214485
Guanylate_cyc 850..1047 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.