DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycbeta100B and gucy2g

DIOPT Version :9

Sequence 1:NP_524603.2 Gene:Gycbeta100B / 43682 FlyBaseID:FBgn0013973 Length:787 Species:Drosophila melanogaster
Sequence 2:XP_009305067.2 Gene:gucy2g / 100333350 ZFINID:ZDB-GENE-130531-70 Length:1127 Species:Danio rerio


Alignment Length:310 Identity:106/310 - (34%)
Similarity:167/310 - (53%) Gaps:42/310 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   474 KLTKNLEMLTDKLQQTFRDLESEKQKTDRLLYSVLPKSVANELRHQRPVPPKRYDSVTLMFSGIV 538
            ||.|....|.:.:::....|..||.:.|:||.|:||:.:|::|...:.|.|:.|:.||:.||.||
Zfish   828 KLEKYANHLEEVVEERTSQLTVEKSRADKLLSSMLPRYIADQLMAGKSVEPRSYEMVTIFFSDIV 892

  Fly   539 GFGQYCAANTDPDGAMKIVKMLNELYTVFDALTDSKRNLNVYKVETVGDKYMAVSGLP-DHCEDH 602
            ||...|:.::    |:::|.:||:||::||   |..:..:||||||:||.||..|||| .:...|
Zfish   893 GFTTMCSVSS----ALEVVTLLNDLYSLFD---DIIKLYDVYKVETIGDAYMVASGLPISNGTLH 950

  Fly   603 AKCMARVALDMMDMAKNVKMGSNP---VQITIGIHSGEVVTGVIGNRVPRYCLFGNTVNLTSRTE 664
            |:.::.:||..:...|..|:...|   :.:.|||:||.||.||:|:.:|||||||:|||..||.|
Zfish   951 AEEISTMALHFLSSIKRFKIRHLPNERLALRIGINSGPVVAGVVGSTMPRYCLFGDTVNTASRME 1015

  Fly   665 TTGVPGRINVSEETYRLLCMAINQDDSFHLEYRGPVIMKGKPTPMDCWFLTRATSSILGGTSSTG 729
            :..:|.:|::|:.|..:| :.|.   :|.||.||.:.:|||.|....|.|::.            
Zfish  1016 SNSLPLKIHISQSTADIL-LTIG---TFELEERGDIEIKGKGTQKTFWLLSKP------------ 1064

  Fly   730 GSGGGGNGSLDSPLLQPATPTAGAATPIPVVAQRAAGHASVSRTSSAGGG 779
                   |....|..|.:.|:..:.|.        :.|....:|.:|..|
Zfish  1065 -------GFTFPPTGQDSNPSPKSGTD--------SCHIKQEKTKAANDG 1099

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycbeta100BNP_524603.2 HNOB 2..164 CDD:285002
HNOBA 326..516 CDD:285003 14/41 (34%)
CYCc 496..688 CDD:214485 81/195 (42%)
Guanylate_cyc 522..714 CDD:278633 81/195 (42%)
gucy2gXP_009305067.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.