DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15556 and rab15

DIOPT Version :9

Sequence 1:NP_001247379.1 Gene:CG15556 / 43681 FlyBaseID:FBgn0039821 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_001016372.1 Gene:rab15 / 549126 XenbaseID:XB-GENE-495026 Length:212 Species:Xenopus tropicalis


Alignment Length:119 Identity:25/119 - (21%)
Similarity:49/119 - (41%) Gaps:31/119 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 AEDFELEYETDEGKEK-----RINRVEKTRVGQKANLRDLCLNERGIPIRRRCQIRNGNRVWQSL 129
            |.|.: ||..| |.:|     :.:..:|.:||:...::  ...|.|:.........|.| :.:|.
 Frog   103 ASDVD-EYAPD-GVQKILIGNKADEEQKRQVGKNQGMK--LAEEYGMDFFETSACTNYN-IKESF 162

  Fly   130 DHVTCRSAPELSSSINLLAVKSPPDMISQLSNLLTQTQEKLAAADVFSISEIFD 183
            ..:|         .:.|:|.|      .:|..|      ::::||..:::|:.|
 Frog   163 TRLT---------ELVLMAHK------RELEGL------RMSSADELNLAELED 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15556NP_001247379.1 7tm_4 481..703 CDD:304433
rab15NP_001016372.1 Rab15 9..172 CDD:206698 17/82 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.