DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15556 and mthl6

DIOPT Version :9

Sequence 1:NP_001247379.1 Gene:CG15556 / 43681 FlyBaseID:FBgn0039821 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_788473.1 Gene:mthl6 / 38839 FlyBaseID:FBgn0035789 Length:480 Species:Drosophila melanogaster


Alignment Length:277 Identity:59/277 - (21%)
Similarity:111/277 - (40%) Gaps:46/277 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   460 SLDVITNVGLTLSLLGLLMIFITAAVFKSFRTLASTKILLNLC--AALGLQLLFFLILSQSHLLE 522
            |:..:..|| |:|::|.:   :|.||:...:.|.:   ||..|  ..:..:.:.:||.:...|  
  Fly   201 SMPAVPQVG-TISMVGCI---LTIAVYLYIKKLRN---LLGKCFICYVFCKFVQYLIWAGGDL-- 256

  Fly   523 QLEQSESERCTLVGAVMQYLLLVVFSWMFIIGFLQYQRYVRVIGVNHPRHYILMSAVAAWTLPLI 587
               ...:..|:|.|....:..|....|:.::.. |..:.:|:|..:...::.|:..:..|..|.|
  Fly   257 ---NLWNNICSLAGYTNYFFALASHFWLSVMSH-QIWKNLRLINRDERSYHFLIYNIYGWGTPAI 317

  Fly   588 PTLLVVFLE---------------PGSYRPNNSSMDYPILCYPSGYGLSLGVILPIGLITVANAI 637
            .|.:...::               .|.||...::.|:..:.|..|..|.|.:...:..|...|.|
  Fly   318 MTAITYLVDWAWEDRPDKLNWIPGVGLYRCWINTYDWSAMIYLYGPMLILSLFNVVTFILTVNHI 382

  Fly   638 LVGYISWSVYTALFKRDLIFKQLGLFVLLFFLLGITWIFGLCTYF----DFGR------IFAYLF 692
            :....|....|...::.:......|::.|..::|:|.|..:.|||    .|.|      .|.:|.
  Fly   383 MKIKSSVKSSTQQQRKCIQNNDFLLYLRLSVMMGVTGISEVITYFVKRHKFWRQVLRVPNFFHLG 447

  Fly   693 CLTATLQGFVLFLYFIV 709
                  .|.|:|:.||:
  Fly   448 ------SGIVVFVLFIL 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15556NP_001247379.1 7tm_4 481..703 CDD:304433 49/248 (20%)
mthl6NP_788473.1 Mth_Ecto 25..197 CDD:119403
7tm_4 211..398 CDD:304433 38/198 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462188
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.