DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15556 and mthl4

DIOPT Version :9

Sequence 1:NP_001247379.1 Gene:CG15556 / 43681 FlyBaseID:FBgn0039821 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_788394.1 Gene:mthl4 / 36960 FlyBaseID:FBgn0034219 Length:517 Species:Drosophila melanogaster


Alignment Length:288 Identity:60/288 - (20%)
Similarity:110/288 - (38%) Gaps:86/288 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   473 LLGLLMIFITAAVFKSFRTLASTKILLNLCAALGLQL-LFFLILSQSHLLEQLEQSESERCTLVG 536
            ::.|:.|.:|.:|:.....|.:......:|....|.| .|||:|:       :.:..|..|...|
  Fly   217 VISLICIILTISVYLYVEKLRNLHGKCFICYLASLFLGYFFLVLN-------VWKYSSGFCVTAG 274

  Fly   537 AVMQYLLLVVFSWMFIIGF-------LQYQRYVRVIGVNHPRHYILMSAVAAWTLPLIPTLLVV- 593
            .:..:.::..|.|:.:||.       |......|::..|..|.|.|.    ||.:|||.|.:.. 
  Fly   275 FLGYFSVMAAFFWLSVIGIHLRIKFSLASNCLHRLLPENPFRAYNLY----AWGIPLIMTAITYT 335

  Fly   594 ---FLEPGSYRPNNS--------SMDYPILCYPSGYGLSLGVILPIGLITVANAILVGYISWSVY 647
               .::....||...        :.|..::.|  .||       |:.|:...|.|:  ::..::|
  Fly   336 ADQVVKNEKLRPRVGVGKNCWIYTGDMTVMIY--FYG-------PMLLLIAFNIIM--FVLSAIY 389

  Fly   648 TALFKRD---LIFKQ-----------LGLFVLLFFLLGITWIFGLCT-----------------Y 681
            ....|::   |:.||           ..:|:.||.|:|::|.|.:.:                 |
  Fly   390 IYNIKKNVKGLVHKQQTNQQINDQQMFAIFLRLFILMGLSWSFEILSFLLTKQQAWARALMVADY 454

  Fly   682 FDFGRIFAYLFCLTATLQGFVLFLYFIV 709
            |::.             ||.::|:.||:
  Fly   455 FNWS-------------QGTIIFVLFIL 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15556NP_001247379.1 7tm_4 481..703 CDD:304433 55/272 (20%)
mthl4NP_788394.1 Methuselah_N 23..201 CDD:284145
7tm_4 213..>385 CDD:304433 41/189 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.