DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15556 and Dh44-R2

DIOPT Version :9

Sequence 1:NP_001247379.1 Gene:CG15556 / 43681 FlyBaseID:FBgn0039821 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_610789.3 Gene:Dh44-R2 / 36368 FlyBaseID:FBgn0033744 Length:476 Species:Drosophila melanogaster


Alignment Length:341 Identity:76/341 - (22%)
Similarity:130/341 - (38%) Gaps:72/341 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   423 ASSHPVILCH----------ADHLTQFTFLLGVSKMQAGLD-TNEDDHSLDVI----TNV----- 467
            |.|..|:.|.          .|:.|:|.|..|.....:..| .:::..|:.|:    .||     
  Fly    99 AGSLAVLPCFEEFKGVHYDTTDNATRFCFPNGTWDHYSDYDRCHQNSGSIPVVPDFSPNVELPAI 163

  Fly   468 ----GLTLSLLGLLMIFITAAVFKSFRTLASTKILLNL------CAALGLQLLFFLILSQSHLLE 522
                |..||...|::..|....||..|.|.:| |..||      .|.|.:..||..:::      
  Fly   164 IYAGGYFLSFATLVVALIIFLSFKDLRCLRNT-IHANLFLTYITSALLWILTLFLQVIT------ 221

  Fly   523 QLEQSESERCTLVGAVMQYLLLVVFSWMFIIGFLQYQRYVRVIGVNHPRHYILMSAVAAWTLPLI 587
             .|.|::...||| .:.||..|..|.|||:.|...|...|:....::..  .::.|:..|..|.:
  Fly   222 -TESSQAGCITLV-IMFQYFYLTNFFWMFVEGLYLYTLVVQTFSSDNIS--FIIYALIGWGCPAV 282

  Fly   588 PTLLVVFLEPGSYRPNNSSMDYPILCYPSGYGLSLGVI------------LPIGLITVANAILVG 640
              .::|:....::.|:..:..:        .||.:...            :|..|..:.|.:.:.
  Fly   283 --CILVWSIAKAFAPHLENEHF--------NGLEIDCAWMRESHIDWIFKVPASLALLVNLVFLI 337

  Fly   641 YISWSVYTALFKRDLI-----FKQLGLFVLLFFLLGITWIFGLCTYFDFG---RIFAYLFCLTAT 697
            .|.|.:.|.|.....:     :|.....::|..|.|||::..| |..:.|   .:|..:.....:
  Fly   338 RIMWVLITKLRSAHTLETRQYYKASKALLVLIPLFGITYLLVL-TGPEQGISRNLFEAIRAFLIS 401

  Fly   698 LQGFVLFLYFIVFNKE 713
            .|||.:.|::...|.|
  Fly   402 TQGFFVALFYCFLNSE 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15556NP_001247379.1 7tm_4 481..703 CDD:304433 55/247 (22%)
Dh44-R2NP_610789.3 HRM 82..144 CDD:280888 10/44 (23%)
7tm_2 159..407 CDD:278432 59/269 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462183
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.