DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15556 and Adgrg5

DIOPT Version :9

Sequence 1:NP_001247379.1 Gene:CG15556 / 43681 FlyBaseID:FBgn0039821 Length:755 Species:Drosophila melanogaster
Sequence 2:XP_008770523.1 Gene:Adgrg5 / 307645 RGDID:1305559 Length:564 Species:Rattus norvegicus


Alignment Length:289 Identity:71/289 - (24%)
Similarity:120/289 - (41%) Gaps:63/289 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 EIKRRPTSNVISITIPGLNDTKLPGKLPFFLRNAKANETQ----FEGGCGYWNYETWLSDGISTS 416
            ::..||.:|:           :.|..:.|:...:....|.    ::.|.|..::..|...|..| 
  Rat   155 QLDHRPVNNL-----------QRPVNISFWHNRSLEGYTVTCVFWKEGAGKHSWGAWSPKGCYT- 207

  Fly   417 GGGSLEASSHPVILCHADHLTQFTFLLGVS--KMQAGLDTNEDDHSLDVITNVGLTLSLLGLLMI 479
                 |..|...:|||.:|||.|..|:.:|  .:...|.|     .|:.|:.||.::|::..|:.
  Rat   208 -----EQPSPTQVLCHCNHLTYFAVLMQLSGDPVPTELQT-----PLEYISLVGCSISIVASLLT 262

  Fly   480 FITAAVFKSFRTLASTKILLNLCAALGLQLLFFLILSQSHLLEQLEQSESERCTLVGAVMQYLLL 544
            .:..|..:.... ::|:|.|||..::.|..:.||:.||. :...:.:|.   ||::.|.:.|.||
  Rat   263 ILLNAHSRKLSD-STTRIHLNLNGSVLLLNITFLLSSQM-VPPTVPRSV---CTVLAATLHYALL 322

  Fly   545 VVFSWMFIIGFLQYQRYVRVIGVNHPRHYILMSA-------VAAWTLPLIPTLLVVFLE-PGS-Y 600
            ...:||.:.||..|....||..|...|....:.|       ::.|      |:..:||: ||. |
  Rat   323 SSLTWMGVEGFNLYLLLGRVYNVYIRRVSSPLGAASSDDQELSVW------TMCDLFLQKPGKWY 381

  Fly   601 R---------PNNSSMDYPILCYPSGYGL 620
            |         ..:....:|      ||||
  Rat   382 RLPECVHVLGTQSHGTQHP------GYGL 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15556NP_001247379.1 7tm_4 481..703 CDD:304433 41/158 (26%)
Adgrg5XP_008770523.1 GPS 184..228 CDD:396408 14/49 (29%)
7tm_GPCRs 243..>349 CDD:421689 32/110 (29%)
TM helix 1 243..268 CDD:410628 6/24 (25%)
TM helix 2 277..299 CDD:410628 8/21 (38%)
TM helix 3 311..338 CDD:410628 10/26 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 99 1.000 Domainoid score I6879
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12011
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.