DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15556 and mthl13

DIOPT Version :9

Sequence 1:NP_001247379.1 Gene:CG15556 / 43681 FlyBaseID:FBgn0039821 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_788325.2 Gene:mthl13 / 246395 FlyBaseID:FBgn0050018 Length:440 Species:Drosophila melanogaster


Alignment Length:296 Identity:49/296 - (16%)
Similarity:109/296 - (36%) Gaps:91/296 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   472 SLLGLLMIFITAAVFKSFRTLASTKILLNLCAALGLQLLFFLILSQSHLLEQLEQSESERCTLVG 536
            |::..::||......|..|. ...|.:::....|.|..|.:| :.:..||:..       |:|.|
  Fly   175 SIICYIIIFGIYLFVKELRN-DFGKCVMSCVFCLFLDYLIWL-MDELRLLDDF-------CSLTG 230

  Fly   537 AVMQYLLLVVFSWMFIIGFLQYQRYVRVIGVNHPRHYILMSAVAAWTLPLIPTLLVVF------- 594
            .:|.:.......|..||.:..:::...|:...:...::..|.. |:.:..||..:::.       
  Fly   231 YIMFFFDFANSVWFSIISYCIWKKITSVVSQENRDQFVFYSTF-AYGISAIPLGIIISINQFWEE 294

  Fly   595 -LEPGSYRP----NNSSMD-------------YPILCYPSGYGLSLGVILPIGLITVAN------ 635
             |...::.|    :..|:|             |.|:|       ::.:|:.:  :|:.:      
  Fly   295 DLRKWNWLPLVGFSRCSVDDCKRSSWVYYFVPYAIMC-------AINIIMFV--LTIKHIMKTKR 350

  Fly   636 --------------AILVGYISWSVYTALFKRDLIFKQLGLFVLLFFLLGITWIFGL-------C 679
                          .:.|.::::.:|.             ||:.:..::|:.||..:       .
  Fly   351 NLHNLTKRPDRNETCVTVNFLNFELYL-------------LFLRISGIMGVAWILIIFLLIEVNS 402

  Fly   680 TYFD-FGRIFAYLFCLTATLQGFVLFLYFIVFNKEN 714
            |::| ||.|...:.      .||.:.|:.::..|.:
  Fly   403 TFWDIFGIIIQQIH------YGFGIILFVLLIFKRS 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15556NP_001247379.1 7tm_4 481..703 CDD:304433 44/274 (16%)
mthl13NP_788325.2 Mth_Ecto <49..158 CDD:299804
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462186
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.