DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15556 and CRHR2

DIOPT Version :9

Sequence 1:NP_001247379.1 Gene:CG15556 / 43681 FlyBaseID:FBgn0039821 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_001189404.1 Gene:CRHR2 / 1395 HGNCID:2358 Length:438 Species:Homo sapiens


Alignment Length:304 Identity:63/304 - (20%)
Similarity:120/304 - (39%) Gaps:56/304 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   443 LGVSKMQAGLDTNEDDHSLD-----VITNVGLTLSLLGLLMIFITAAVFKSFRTLASTKILLNLC 502
            :..|:.:..||..:..:.|.     |:..:|..:|:..|:..|:.....:|.|.|.:. |..||.
Human   120 INYSQCEPILDDKQRKYDLHYRIALVVNYLGHCVSVAALVAAFLLFLALRSIRCLRNV-IHWNLI 183

  Fly   503 AALGLQ-LLFFLILSQSHLLEQLEQSESERCTLVGAVMQYLLLVVFSWMFIIGFLQYQRYVRVIG 566
            ....|: :::||:....|   ::.:|....|..:..:..|.::..|.|||:.|...:...|....
Human   184 TTFILRNVMWFLLQLVDH---EVHESNEVWCRCITTIFNYFVVTNFFWMFVEGCYLHTAIVMTYS 245

  Fly   567 VNHPRHYILMSAVAAWTLPLIPTLLVVFLEPGSYRPNNSSMDYPILCYPSGYGLSLGVIL----- 626
            ....|..:.:  ...|.:|.  .::|.:.....|..|..       |:   :|...|.::     
Human   246 TERLRKCLFL--FIGWCIPF--PIIVAWAIGKLYYENEQ-------CW---FGKEPGDLVDYIYQ 296

  Fly   627 -PIGLITVANAILVGYI----------SWSVYTALFKRDLIFKQLGLFVLLFFLLGITWIFGLCT 680
             ||.|:.:.|.:.:..|          |.:..|..::     |.:...::|..|||||::.    
Human   297 GPIILVLLINFVFLFNIVRILMTKLRASTTSETIQYR-----KAVKATLVLLPLLGITYML---- 352

  Fly   681 YF------DFGRI-FAYLFCLTATLQGFVLFLYFIVFNKENQRA 717
            :|      |..:| |.|......:.|||.:.:::..||.|.:.|
Human   353 FFVNPGEDDLSQIMFIYFNSFLQSFQGFFVSVFYCFFNGEVRSA 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15556NP_001247379.1 7tm_4 481..703 CDD:304433 50/245 (20%)
CRHR2NP_001189404.1 HormR 63..134 CDD:214468 3/13 (23%)
7tm_2 140..382 CDD:278432 55/268 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.