DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15556 and mthl11

DIOPT Version :9

Sequence 1:NP_001247379.1 Gene:CG15556 / 43681 FlyBaseID:FBgn0039821 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_731479.3 Gene:mthl11 / 117467 FlyBaseID:FBgn0045443 Length:532 Species:Drosophila melanogaster


Alignment Length:274 Identity:45/274 - (16%)
Similarity:106/274 - (38%) Gaps:43/274 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   464 ITNVGLTLSLLGLLMIFITAAVF---KSFRTLASTKILLNLCAALGLQLLFFLILSQSHLLEQLE 525
            ::|..:.:....:..:.||.|.:   ..||:|...      |..     |:|:.|:.:.||..:.
  Fly   225 LSNASIPVKFSSVFFMVITIAAYLWLPKFRSLHGK------CCN-----LYFICLAITFLLNVIS 278

  Fly   526 -----QSESERCTLVGAVMQYLLLVVFSWMFIIGFLQYQRY-VRVIGVNHPR------HYILMSA 578
                 :.::..|.|.|....:.::..|.|:.:|.|..::|: :|...|.:..      :|.::..
  Fly   279 LFGIFELKTPICYLTGYAGYFTVMATFLWLSVISFDVWRRFAMRKFQVFYKNKRSSFFNYNIIVW 343

  Fly   579 VAAWTLPLIPTLLVVFLEPGSYRPNNSSMD-YPILCYPSGYGLSLGVILPIGLITVANAILVGYI 642
            .:|..|..|..|:..|:|.....|.|.::. :....:.:|:..:.....|:.::.:.|.......
  Fly   344 SSAGLLTCIIFLVDQFVETNLDNPYNPAVGVFSCWIFTNGWSATFYFYAPLAILIILNCASFFLT 408

  Fly   643 SWSVYTALFKRDLIFK------------QLGLFVLLFFLLGITWIFGLCTYF-DFGRIFAYLFCL 694
            :..:|....:...:..            ...::..||.::|.:|...:..:. :...::..|..|
  Fly   409 TRYIYVENKQNQKVLNNSEPQKLSRNHANYRIYFRLFIIMGGSWFLEIIAFICEMENMWKPLIIL 473

  Fly   695 TATL---QGFVLFL 705
            ...:   ||.::|:
  Fly   474 NDYINCSQGIIIFV 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15556NP_001247379.1 7tm_4 481..703 CDD:304433 43/253 (17%)
mthl11NP_731479.3 Methuselah_N 26..204 CDD:310923
7tmB3_Methuselah-like 236..504 CDD:320167 44/263 (17%)
TM helix 2 258..280 CDD:320167 6/32 (19%)
TM helix 3 291..318 CDD:320167 6/26 (23%)
TM helix 4 335..355 CDD:320167 4/19 (21%)
TM helix 5 383..412 CDD:320167 3/28 (11%)
TM helix 6 433..460 CDD:320167 4/26 (15%)
TM helix 7 468..493 CDD:320167 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.