DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and Psmb1

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_446042.1 Gene:Psmb1 / 94198 RGDID:621092 Length:240 Species:Rattus norvegicus


Alignment Length:245 Identity:49/245 - (20%)
Similarity:87/245 - (35%) Gaps:57/245 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RTTIFSPEGRLYQVEYAMEA-ASQSGTCVGLLAKNGVLLATERSVD--------------KLMDT 57
            |..:..|:|....|:..... |...||.:.:..::..::|::..:.              ||.|.
  Rat    12 RELVMGPQGSAGPVQMRFSPYAFNGGTVLAIAGEDFSIVASDTRLSEGFSIHTRDSPKCYKLTDK 76

  Fly    58 SIPVPRISWLNENIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQ 122
            ::           |.|  :|...|...|...:....:.|:.:..:.:....:...|..|..:...
  Rat    77 TV-----------IGC--SGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRF 128

  Fly   123 YGGKRPFGVSFLYMGWDCRFGFQLYQSDPSGNY--SGWKATCIGRKSGAAMEMLQ---------K 176
            :    |:.|..:..|.|......:|..||.|:|  ..:||      .|:|..|||         |
  Rat   129 F----PYYVYNIIEGLDEEGKGAVYSFDPVGSYQRDSFKA------GGSASAMLQPLLDNQVGFK 183

  Fly   177 ELFSKGYVSPSVEEA----KDVAIKVMGMTLGRDSLTPEKLEIAFVQRYG 222
            .:.:..:|..:::.|    |||.|.    ...||..|.:.|.|..|.:.|
  Rat   184 NMQNVEHVPLTLDRAMRLVKDVFIS----AAERDVYTGDALRICIVTKEG 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 49/245 (20%)
Ntn_hydrolase 3..218 CDD:294319 47/239 (20%)
Psmb1NP_446042.1 proteasome_beta_type_1 29..240 CDD:239726 45/228 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.