DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and PRE1

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_010928.1 Gene:PRE1 / 856731 SGDID:S000000814 Length:198 Species:Saccharomyces cerevisiae


Alignment Length:153 Identity:38/153 - (24%)
Similarity:64/153 - (41%) Gaps:48/153 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VGLLAKNGVLLATERSV-----------DKLMDTSIPVPRISWLNENIACCATGNTA------DG 82
            :|:..::.|:||:.::|           ||....| |...:|:..|      .|:|.      ..
Yeast     5 LGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLS-PHTLMSFAGE------AGDTVQFAEYIQA 62

  Fly    83 NVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQ-YGGKRPFGVSFLYMGWDCRFGF-Q 145
            |:   ||..|.:.|     |:.|  |.|::.  ::|...: ...:||:.|:.|..|:|.:... :
Yeast    63 NI---QLYSIREDY-----ELSP--QAVSSF--VRQELAKSIRSRRPYQVNVLIGGYDKKKNKPE 115

  Fly   146 LYQSD--------PSG--NYSGW 158
            |||.|        |.|  .|||:
Yeast   116 LYQIDYLGTKVELPYGAHGYSGF 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 38/153 (25%)
Ntn_hydrolase 3..218 CDD:294319 38/153 (25%)
PRE1NP_010928.1 proteasome_beta_type_2 1..194 CDD:239727 38/153 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.