DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and PRE2

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_015428.1 Gene:PRE2 / 856218 SGDID:S000006307 Length:287 Species:Saccharomyces cerevisiae


Alignment Length:218 Identity:46/218 - (21%)
Similarity:82/218 - (37%) Gaps:46/218 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TCVGLLAKNGVLLATE-RSVDKLMDTSIPVPRISWLNENIACCATGNTADGNVLVNQLRMIAQQY 96
            |.:....:.|:::|.: |:.......|..|.::..:|..:.....|..||.......|....:.:
Yeast    77 TTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWETWLGSQCRLH 141

  Fly    97 QFNFGEMI---PCEQLVTNLCDIKQAYTQYGGKRPFGVSF--LYMGWDCRFGFQLYQSDPSGNYS 156
            :....|.|   ...::::||     .| ||.|.   |:|.  :..|:..:.|..:|..|..|...
Yeast   142 ELREKERISVAAASKILSNL-----VY-QYKGA---GLSMGTMICGYTRKEGPTIYYVDSDGTRL 197

  Fly   157 GWKATCIGRKSGAAMEMLQKELFSKGYVSP------SVEEAKDVAIKVMGMTLGRDSLTPEKLEI 215
            .....|:|  ||        :.|:.|.:..      |||:|         :.||:.|:    |..
Yeast   198 KGDIFCVG--SG--------QTFAYGVLDSNYKWDLSVEDA---------LYLGKRSI----LAA 239

  Fly   216 AFVQRY--GNTTVFHILEKNEIH 236
            |....|  |:..::|:.|...|:
Yeast   240 AHRDAYSGGSVNLYHVTEDGWIY 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 46/218 (21%)
Ntn_hydrolase 3..218 CDD:294319 41/196 (21%)
PRE2NP_015428.1 proteasome_beta_type_5 76..264 CDD:239730 46/218 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.