Sequence 1: | NP_651843.1 | Gene: | Prosalpha3T / 43679 | FlyBaseID: | FBgn0261395 | Length: | 251 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_014800.3 | Gene: | PUP1 / 854328 | SGDID: | S000005683 | Length: | 261 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 255 | Identity: | 58/255 - (22%) |
---|---|---|---|
Similarity: | 90/255 - (35%) | Gaps: | 91/255 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 EAASQSGTCVGLLAKNGVLLATE-RSVDKLMDTSIPVPRISWLNENIACCATGNTAD-------- 81
Fly 82 -GNV------------LVNQLRMIAQ---QYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPFG 130
Fly 131 VSFLYMGWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQ---KELFSKGYVSPSVEEAK 192
Fly 193 DVA-----------------IKVMGMTLGRDS------LTP---EKLEIAFVQRYGNTTV 226 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosalpha3T | NP_651843.1 | PTZ00246 | 1..241 | CDD:173491 | 58/255 (23%) |
Ntn_hydrolase | 3..218 | CDD:294319 | 55/245 (22%) | ||
PUP1 | NP_014800.3 | proteasome_beta_type_7 | 30..219 | CDD:239732 | 49/225 (22%) |
Pr_beta_C | 223..257 | CDD:403609 | 4/19 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |