DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and PUP1

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_014800.3 Gene:PUP1 / 854328 SGDID:S000005683 Length:261 Species:Saccharomyces cerevisiae


Alignment Length:255 Identity:58/255 - (22%)
Similarity:90/255 - (35%) Gaps:91/255 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EAASQSGTCVGLLAKNGVLLATE-RSVDKLMDTSIPVPRISWLNENIACCATGNTAD-------- 81
            :|.|...|.||:...|||::|.: ||....:.......::..::..|.|...|..||        
Yeast    24 KATSTGTTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVTQLI 88

  Fly    82 -GNV------------LVNQLRMIAQ---QYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPFG 130
             .|:            :|:.|:|:.|   :||.:.|                 ||....|..|.|
Yeast    89 GSNIELHSLYTSREPRVVSALQMLKQHLFKYQGHIG-----------------AYLIVAGVDPTG 136

  Fly   131 VSFLYMGWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQ---KELFSKGYVSPSVEEAK 192
             |.|       |....:.|...|.|     ..:|..|.|||.:|:   |:..:|       |||.
Yeast   137 -SHL-------FSIHAHGSTDVGYY-----LSLGSGSLAAMAVLESHWKQDLTK-------EEAI 181

  Fly   193 DVA-----------------IKVMGMTLGRDS------LTP---EKLEIAFVQRYGNTTV 226
            .:|                 :.|..|.:|:|:      |||   |:.:.::....|.|.|
Yeast   182 KLASDAIQAGIWNDLGSGSNVDVCVMEIGKDAEYLRNYLTPNVREEKQKSYKFPRGTTAV 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 58/255 (23%)
Ntn_hydrolase 3..218 CDD:294319 55/245 (22%)
PUP1NP_014800.3 proteasome_beta_type_7 30..219 CDD:239732 49/225 (22%)
Pr_beta_C 223..257 CDD:403609 4/19 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.