DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and SCL1

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_011504.3 Gene:SCL1 / 852873 SGDID:S000002979 Length:252 Species:Saccharomyces cerevisiae


Alignment Length:243 Identity:74/243 - (30%)
Similarity:117/243 - (48%) Gaps:16/243 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FDSRTTIFSPEGRLYQVEYAMEAASQSGTCVGLLAKNG----VLLATERSVDKLMDTSIPVPRIS 65
            :|...|||||||||||||||.:|.:|  |.:..||..|    |:::.::..|||:|.: .|..|.
Yeast    12 YDRHITIFSPEGRLYQVEYAFKATNQ--TNINSLAVRGKDCTVVISQKKVPDKLLDPT-TVSYIF 73

  Fly    66 WLNENIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPFG 130
            .::..|.....|...|......:.:..|.::::.:|..:||:.|...:.::.|.|||....||.|
Yeast    74 CISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQRAYMRPLG 138

  Fly   131 VSFLYMGWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYV----SPSVEEA 191
            |...::..|...|..:|::||:|.|.|:|||..|.|.......|:.. |.|..:    ..|.|:.
Yeast   139 VILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENH-FKKSKIDHINEESWEKV 202

  Fly   192 KDVAIKVMGMTLGRDSLTPEKLEIAFVQRYGNTTVFHILEKNEIHRLI 239
            .:.||..|...||.: .:...||:....:   ...|.:..:|...||:
Yeast   203 VEFAITHMIDALGTE-FSKNDLEVGVATK---DKFFTLSAENIEERLV 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 74/243 (30%)
Ntn_hydrolase 3..218 CDD:294319 70/220 (32%)
SCL1NP_011504.3 proteasome_alpha_type_6 12..228 CDD:239723 70/220 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.