DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and PRE7

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_009512.1 Gene:PRE7 / 852239 SGDID:S000000137 Length:241 Species:Saccharomyces cerevisiae


Alignment Length:253 Identity:64/253 - (25%)
Similarity:102/253 - (40%) Gaps:59/253 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EYAMEAAS------------QSGTCVGLLAKNGVLLATE-RSVDKLMDTSIPVPRISWLNENIAC 73
            ||:.||::            ..||.:|:..::..:||.: |::......|...|::....:||..
Yeast     7 EYSSEASNTPIEHQFNPYGDNGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVM 71

  Fly    74 CATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKR--PFGVSFLYM 136
            .|.|..|||:.||.:.:...:.|.|:..:    ::|..|.......:..| |||  |:.|..:..
Yeast    72 SANGFAADGDALVKRFKNSVKWYHFDHND----KKLSINSAARNIQHLLY-GKRFFPYYVHTIIA 131

  Fly   137 GWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAA----MEMLQKELFSKGYVSP----------- 186
            |.|......:|..||.|:|.  :..|  |..|||    |..|..::..|....|           
Yeast   132 GLDEDGKGAVYSFDPVGSYE--REQC--RAGGAAASLIMPFLDNQVNFKNQYEPGTNGKVKKPLK 192

  Fly   187 --SVEEAKDVAIKVMGMTLGRDSLTP---------EKLEIAFVQRYGNTTVFHILEKN 233
              ||||    .||::     |||.|.         :.|||..|.:.|....|:.|:::
Yeast   193 YLSVEE----VIKLV-----RDSFTSATERHIQVGDGLEILIVTKDGVRKEFYELKRD 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 64/253 (25%)
Ntn_hydrolase 3..218 CDD:294319 60/236 (25%)
PRE7NP_009512.1 proteasome_beta_type_1 21..241 CDD:239726 60/237 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.