DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and AT1G79210

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001077845.1 Gene:AT1G79210 / 844262 AraportID:AT1G79210 Length:235 Species:Arabidopsis thaliana


Alignment Length:230 Identity:84/230 - (36%)
Similarity:119/230 - (51%) Gaps:17/230 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TIFSPEGRLYQVEYAMEAASQSGTCVGLLAKNGVLLATERSVDKLMDTSIPVPRISWLNENIACC 74
            |.|||.|:|.|:|:|:.|.....|.:|:.|.|||::|||:.:..::.....|.:|..|..||...
plant    11 TTFSPSGKLVQIEHALTAVGSGQTSLGIKASNGVVIATEKKLPSILVDEASVQKIQHLTPNIGTV 75

  Fly    75 ATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPFGVSFLYMGWD 139
            .:|...|..|||.:.|..|:||...:.|.||..|||.....:.|.:||.||.||||||.|..|:|
plant    76 YSGMGPDFRVLVRKSRKQAEQYLRLYKEPIPVTQLVRETATVMQEFTQSGGVRPFGVSLLVAGYD 140

  Fly   140 CRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSVEEAK-DVAIKVMGMTL 203
            .: |.||||.||||:|..|||:.:|:....|...|:|..         .|:.: |.||....:||
plant   141 DK-GPQLYQVDPSGSYFSWKASAMGKNVSNAKTFLEKRY---------TEDMELDDAIHTAILTL 195

  Fly   204 G---RDSLTPEKLEIAFVQRYGNTTVFHILEKNEI 235
            .   ...::.:.:||.   :.|...||.:|...||
plant   196 KEGFEGEISSKNIEIG---KIGTDKVFRVLTPAEI 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 84/230 (37%)
Ntn_hydrolase 3..218 CDD:294319 78/211 (37%)
AT1G79210NP_001077845.1 proteasome_alpha_type_2 6..232 CDD:239719 84/230 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.