DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and PAF2

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_175158.1 Gene:PAF2 / 841128 AraportID:AT1G47250 Length:277 Species:Arabidopsis thaliana


Alignment Length:237 Identity:81/237 - (34%)
Similarity:124/237 - (52%) Gaps:10/237 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FDSRTTIFSPEGRLYQVEYAMEAASQSGTCVGLLAKNGVLLATERSVDKLM-DTSIPVPRISWLN 68
            :|:..|.:||.|||:||||||||..|....:||.:::.|:||   .|:|.. :.|....:|..::
plant     6 YDTDVTTWSPTGRLFQVEYAMEAVKQGSAAIGLRSRSHVVLA---CVNKAQSELSSHQRKIFKVD 67

  Fly    69 ENIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPFGVSF 133
            ::|.....|.||||.||...:|..:..:.|.:...:|..:||.:|.|..|..||...|||:||..
plant    68 DHIGVAIAGLTADGRVLSRYMRSESINHSFTYESPLPVGRLVVHLADKAQVCTQRSWKRPYGVGL 132

  Fly   134 LYMGWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSVEEAKDVAIKV 198
            |..|.| ..|..||.:.|||||..::|..||.:|.||...|:::.  :.:...|.|:....||..
plant   133 LVGGLD-ESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERKF--ESFQESSKEDLIKDAIMA 194

  Fly   199 MGMTLGRDSLTPEKLEIAFVQRYGNTTVFHILEKNEIHRLIE 240
            :..||..::|   |..:..|...|....||.|::..|.::|:
plant   195 IRETLQGETL---KSSLCTVSVLGVDEPFHFLDQESIQKVID 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 81/237 (34%)
Ntn_hydrolase 3..218 CDD:294319 74/213 (35%)
PAF2NP_175158.1 proteasome_alpha_type_1 6..215 CDD:239718 75/217 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.