DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and psma6l

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_571870.2 Gene:psma6l / 83917 ZFINID:ZDB-GENE-010502-2 Length:252 Species:Danio rerio


Alignment Length:239 Identity:85/239 - (35%)
Similarity:125/239 - (52%) Gaps:10/239 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FDSRTTIFSPEGRLYQVEYAMEAASQSG-TCVGLLAKNGVLLATERSV-DKLMDTSIPVPRISWL 67
            ||...|||||||||||||||.:|.|||| |.||:...:..:|.|::.| |.|:|.| .:..:..:
Zfish     9 FDRHITIFSPEGRLYQVEYAFKAISQSGLTTVGIRGVDCAVLVTQKKVSDTLLDAS-TMTNMFRI 72

  Fly    68 NENIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPFGVS 132
            ...|.|..||:.||....|::.|:.|.::::.||..:|.:.|...|.|:.|.|||....||.|..
Zfish    73 TPRIGCVMTGHYADSRSQVHRARIEAGEWKYKFGYDVPVDALCRRLADLSQVYTQNAEMRPLGCC 137

  Fly   133 FLYMGWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKEL----FSKGYVSPSVEEAKD 193
            .:.:..|.:.|..||:.||:|.:.|::||.:|.|...|...|:|::    ..|..|....:.:..
Zfish   138 MMLISMDPQKGPMLYKCDPAGYFCGFRATSVGVKHTEANSYLEKKIKKMQKKKEEVELDFDSSVQ 202

  Fly   194 VAIKVMGMTLGRDSLTPEKLEIAFVQRYGNTTVFHILEKNEIHR 237
            :||..:...|..|....| ||:|.|.:  ....|..|.:.||.|
Zfish   203 MAISCLSSVLCMDFKCTE-LEVAVVTK--ENPKFRTLSEVEIER 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 85/239 (36%)
Ntn_hydrolase 3..218 CDD:294319 79/218 (36%)
psma6lNP_571870.2 PRE1 7..252 CDD:223711 85/239 (36%)
proteasome_alpha_type_6 8..226 CDD:239723 79/218 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.