DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and PBC1

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_564149.1 Gene:PBC1 / 838776 AraportID:AT1G21720 Length:204 Species:Arabidopsis thaliana


Alignment Length:104 Identity:22/104 - (21%)
Similarity:42/104 - (40%) Gaps:24/104 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VGLLAKNGVLLATERSVD-KLMDTSIPVPRISWLNENIACCATGNTADGNVL---------VNQL 89
            |.::.||...:|::|.:. :|...:....|||.:::.:....:|...|...|         :.||
plant    12 VAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRVFIGLSGLATDVQTLYQRLVFRHKLYQL 76

  Fly    90 R-------------MIAQQYQFNFGEMIPCEQLVTNLCD 115
            |             :.|..|:..||..: |:.::..|.|
plant    77 REERDMKPETFASLVSAILYEKRFGPYL-CQPVIAGLGD 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 22/104 (21%)
Ntn_hydrolase 3..218 CDD:294319 22/104 (21%)
PBC1NP_564149.1 proteasome_beta_type_3 6..200 CDD:239728 22/104 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.