DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and PAD2

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_201415.1 Gene:PAD2 / 836746 AraportID:AT5G66140 Length:250 Species:Arabidopsis thaliana


Alignment Length:244 Identity:86/244 - (35%)
Similarity:130/244 - (53%) Gaps:16/244 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARFFDSRTTIFSPEGRLYQVEYAMEAASQSGTCVGLLAKNGVLLATE-RSVDKLMDTSIPVPRI 64
            ||| :|...|:|||:|.|:|||||:||..:....||:...:.|:||.| :|..||.| |....:|
plant     1 MAR-YDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTVVLAVEKKSTPKLQD-SRSARKI 63

  Fly    65 SWLNENIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPF 129
            ..|:.:||....|..||..||:|:.|:..|.::....:.:..|.:...:..::|.|||.||.|||
plant    64 VSLDNHIALACAGLKADARVLINKARIECQSHRLTLEDPVTVEYITRYIAGLQQKYTQSGGVRPF 128

  Fly   130 GVSFLYMGWD--CRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSVEEAK 192
            |:|.|.:|:|  .|.. .|||:||||.:|.|||...||.|.:..|.|:     |.|...|.:|..
plant   129 GLSTLIVGFDPYSRLP-SLYQTDPSGTFSAWKANATGRNSNSIREFLE-----KNYKESSGQETI 187

  Fly   193 DVAIKVMGMTLGRDSLTPEKLEIAFVQRYGNTTVFHILEKNEIHRLIER 241
            .:||:.:...:....   :.:|:|.:.|  ..|....||:.||..::.:
plant   188 KLAIRALLEVVESGG---KNIEVAVMTR--EETGLRQLEEAEIDAIVAK 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 86/242 (36%)
Ntn_hydrolase 3..218 CDD:294319 78/217 (36%)
PAD2NP_201415.1 PRK03996 1..229 CDD:235192 86/240 (36%)
proteasome_alpha_type_7 4..210 CDD:239724 77/215 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.