DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and PAD1

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_190694.1 Gene:PAD1 / 824289 AraportID:AT3G51260 Length:250 Species:Arabidopsis thaliana


Alignment Length:242 Identity:85/242 - (35%)
Similarity:129/242 - (53%) Gaps:16/242 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARFFDSRTTIFSPEGRLYQVEYAMEAASQSGTCVGLLAKNGVLLATE-RSVDKLMDTSIPVPRI 64
            ||| :|...|:|||:|.|:|||||:||..:....||:...:.|:||.| :|..||.| |....:|
plant     1 MAR-YDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTVVLAVEKKSTPKLQD-SRSARKI 63

  Fly    65 SWLNENIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPF 129
            ..|:.:||....|..||..||:|:.|:..|.::....:.:..|.:...:..::|.|||.||.|||
plant    64 VSLDNHIALACAGLKADARVLINKARIECQSHRLTLEDPVTVEYITRYIAGLQQKYTQSGGVRPF 128

  Fly   130 GVSFLYMGWD--CRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSVEEAK 192
            |:|.|.:|:|  .|.. .|||:||||.:|.|||...||.|.:..|.|:     |.|...:.:|..
plant   129 GLSTLIVGFDPYTRIP-ALYQTDPSGTFSAWKANATGRNSNSIREFLE-----KNYKESAGQETV 187

  Fly   193 DVAIKVMGMTLGRDSLTPEKLEIAFVQRYGNTTVFHILEKNEIHRLI 239
            .:||:.:...:....   :.:|:|.:.|  ...|...||:.||..::
plant   188 KLAIRALLEVVESGG---KNIEVAVMTR--EEGVLKQLEEEEIDIIV 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 85/242 (35%)
Ntn_hydrolase 3..218 CDD:294319 77/217 (35%)
PAD1NP_190694.1 proteasome_alpha_type_7 4..210 CDD:239724 76/215 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.