DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and PBB1

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_566818.1 Gene:PBB1 / 822364 AraportID:AT3G27430 Length:273 Species:Arabidopsis thaliana


Alignment Length:178 Identity:43/178 - (24%)
Similarity:78/178 - (43%) Gaps:27/178 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TCVGLLAKNGVLL-----ATERSV--DKLMDTSIPVPRISWLNENIACCATGNTADGNVLVNQLR 90
            |.|||:.|:||:|     |||..:  ||..:      :|.::..||.||..|..||...:.:   
plant    41 TIVGLIFKDGVILGADTRATEGPIVADKNCE------KIHYMAPNIYCCGAGTAADTEAVTD--- 96

  Fly    91 MIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPFGVSFLYMGWDCRFGFQLYQSDPSGNY 155
            |::.|.:.:..:.....:::|.|..:|:....|.|.  ...:.:..|.|.. |..|:...|.|:.
plant    97 MVSSQLRLHRYQTGRDSRVITALTLLKKHLFSYQGH--VSAALVLGGVDIT-GPHLHTIYPHGST 158

  Fly   156 SGWKATCIGRKSGAAMEMLQKELFSKGYVSPSVEEAKDVAIKVMGMTL 203
            .......:|..|.|||.:.:.: :.:|.       .:|..||::..::
plant   159 DTLPFATMGSGSLAAMSVFEAK-YKEGL-------TRDEGIKLVAESI 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 43/178 (24%)
Ntn_hydrolase 3..218 CDD:294319 43/178 (24%)
PBB1NP_566818.1 proteasome_beta_type_7 40..228 CDD:239732 43/178 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.