DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and PAC1

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_188850.1 Gene:PAC1 / 821774 AraportID:AT3G22110 Length:250 Species:Arabidopsis thaliana


Alignment Length:245 Identity:117/245 - (47%)
Similarity:166/245 - (67%) Gaps:8/245 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARFFDSRTTIFSPEGRLYQVEYAMEAASQSGTCVGLLAKNGVLLATERSV-DKLMDTSIPVPRI 64
            |:|.:||||||||||||||||||||||...:|:.:|:|:|:||:|..|:.| .||:.||....::
plant     1 MSRRYDSRTTIFSPEGRLYQVEYAMEAIGNAGSAIGILSKDGVVLIGEKKVTSKLLQTSTSAEKM 65

  Fly    65 SWLNENIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPF 129
            ..:::::||...|..:|.|:|:|..|:.||:|.|.:.|.:|.||||.:|||.||.|||:||.|||
plant    66 YKIDDHVACAVAGIMSDANILINTARVQAQRYTFMYQEPMPVEQLVQSLCDTKQGYTQFGGLRPF 130

  Fly   130 GVSFLYMGWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSV-EEAKD 193
            |||||:.|||...|||||.|||||||.||||..:|..:.||..:|:::     |...:. |||.:
plant   131 GVSFLFAGWDKHHGFQLYMSDPSGNYGGWKAAAVGANNQAAQSILKQD-----YKDDATREEAVE 190

  Fly   194 VAIKVMGMTLGRDSLTPEKLEIAFVQRYGNTTV-FHILEKNEIHRLIERN 242
            :|:||:..|:...|||.||||:|.|....:.|| :|:.....:.:|:.::
plant   191 LALKVLTKTMDSTSLTSEKLELAEVYLTPSKTVKYHVHSPESLTKLLVKH 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 117/242 (48%)
Ntn_hydrolase 3..218 CDD:294319 111/216 (51%)
PAC1NP_188850.1 proteasome_alpha_type_4 3..215 CDD:239721 111/216 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 210 1.000 Domainoid score I795
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 274 1.000 Inparanoid score I898
OMA 1 1.010 - - QHG54118
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 1 1.000 - - FOG0003645
OrthoInspector 1 1.000 - - mtm1202
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2516
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.940

Return to query results.
Submit another query.