DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and PAG1

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001323455.1 Gene:PAG1 / 817244 AraportID:AT2G27020 Length:351 Species:Arabidopsis thaliana


Alignment Length:209 Identity:63/209 - (30%)
Similarity:104/209 - (49%) Gaps:20/209 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FDSRTTIFSPEGRLYQVEYAMEAASQSGTCVGLLAKNGVLLATERSVDKLMDTSIPVP----RIS 65
            :|...|.|||:||::|:|||.:|...|||.||:..|:|:::    .|:||:.:.:.:|    ||.
plant   110 YDLSVTTFSPDGRVFQIEYAAKAVDNSGTVVGIKCKDGIVM----GVEKLIASKMMLPGSNRRIH 170

  Fly    66 WLNENIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPFG 130
            .::.:......|..|||..:|.:.:..|:.|:..:|:.:|.::|...:.......|.|...||||
plant   171 SVHRHAGMAVAGLAADGRQIVARAKSEARSYESVYGDAVPVKELSERVASYVHLCTLYWWLRPFG 235

  Fly   131 VSFLYMGWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSV------- 188
            ...:..|:| |.|.|||..:|||....:....||:...||...::|...|:......|       
plant   236 CGVILGGYD-RDGPQLYMIEPSGISYRYFGAAIGKGKQAAKTEIEKLNLSEMTCKEGVIEVAKII 299

  Fly   189 ----EEAKDVAIKV 198
                :||||.|.::
plant   300 YKLHDEAKDKAFEL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 63/209 (30%)
Ntn_hydrolase 3..218 CDD:294319 63/209 (30%)
PAG1NP_001323455.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.