DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and PAA2

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_178641.1 Gene:PAA2 / 815135 AraportID:AT2G05840 Length:246 Species:Arabidopsis thaliana


Alignment Length:233 Identity:83/233 - (35%)
Similarity:125/233 - (53%) Gaps:8/233 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FDSRTTIFSPEGRLYQVEYAMEAASQSG-TCVGLLAKNGVLLATERSV-DKLMDTSIPVPRISWL 67
            :|...|||||||||:|||||.:|...:| |.:|:..|:.|.:.|::.| |||:|.| .|..:..:
plant     9 YDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLLDQS-SVSHLFPV 72

  Fly    68 NENIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPFGVS 132
            .:.:...|||.|||...||.|.|..|.:::|.:|..:|.:.|...:.|..|.|||:...||.||.
plant    73 TKYLGLLATGMTADSRSLVQQARNEAAEFRFQYGYEMPADILAKWIADKSQVYTQHAYMRPLGVV 137

  Fly   133 FLYMGWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSVEEAKDVAIK 197
            .:.:|.|...|..||:.||:|::.|.|||..|.|...|:..|:|::  |...:.:.:|....||.
plant   138 AMVLGIDEERGPLLYKCDPAGHFYGHKATSAGMKEQEAVNFLEKKM--KENPAFTYDETVQTAIS 200

  Fly   198 VMGMTLGRDSLTPEKLEIAFVQRYGNTTVFHILEKNEI 235
            .:...|..|....| :|:..|:  .:..:|..|...||
plant   201 ALQSVLQEDFKATE-IEVGVVR--ADDPLFRSLRTEEI 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 83/233 (36%)
Ntn_hydrolase 3..218 CDD:294319 78/214 (36%)
PAA2NP_178641.1 proteasome_alpha_type_6 8..220 CDD:239723 78/214 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.