DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and Psma8

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001157081.1 Gene:Psma8 / 73677 MGIID:1920927 Length:250 Species:Mus musculus


Alignment Length:242 Identity:85/242 - (35%)
Similarity:134/242 - (55%) Gaps:11/242 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARFFDSRTTIFSPEGRLYQVEYAMEAASQSGTCVGLLAKNGVLLATE-RSVDKLMDTSIPVPRI 64
            ||..:|...|:|||:|.|:|||||.||..:..|.||:...|.|:|..| :||.||.|.. .|.:|
Mouse     1 MASRYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGIRGTNIVVLGVEKKSVAKLQDER-TVRKI 64

  Fly    65 SWLNENIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPF 129
            ..|::::.....|.|||..|::::.|:..|.::....:.:..|.:...:..:||.|||..|:|||
Mouse    65 CALDDHVCMAFAGLTADARVVISRARVECQSHKLTVEDPVTVEYITRFIATLKQKYTQSNGRRPF 129

  Fly   130 GVSFLYMGWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSVEEAKDV 194
            |:|.|.:|:|.....:|||:||||.|..|||..|||.:....|.|:|. :::..:| :.:||..:
Mouse   130 GISALIVGFDDDGIPRLYQTDPSGTYHAWKANAIGRSAKTVREFLEKN-YTEDAIS-NDKEAIKL 192

  Fly   195 AIKVMGMTLGRDSLTPEKLEIAFVQRYGNTTVFHI----LEKNEIHR 237
            |||.:...:....   :.:|:|.::|.....:|..    ||.:||.|
Mouse   193 AIKALLEVVQSGG---KNIELAIIRRDQPLKMFSAKEIELEVSEIER 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 85/242 (35%)
Ntn_hydrolase 3..218 CDD:294319 76/215 (35%)
Psma8NP_001157081.1 PRK03996 5..235 CDD:235192 81/235 (34%)
proteasome_alpha_type_7 5..213 CDD:239724 76/213 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.