DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and psmb13a

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_571752.2 Gene:psmb13a / 64280 ZFINID:ZDB-GENE-001208-2 Length:281 Species:Danio rerio


Alignment Length:168 Identity:44/168 - (26%)
Similarity:75/168 - (44%) Gaps:14/168 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ASQSGTCV-GLLAKNGVLLA--TERSVDKLMDTSIPVPRISWLNENIACCATGNTADGNVLVNQL 89
            |.::||.: |::.|:||:|.  |..:.|:::...: ..:|.::..||.||..|..||.....:.|
Zfish    40 ALKTGTTIAGVVFKDGVVLGADTRATSDEVVADKM-CAKIHYIAPNIYCCGAGTAADTEKTTDML 103

  Fly    90 RMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPFGVSFLYMGWDCRFGFQLYQSDPSGN 154
            ......:..|.|.. |...:..|:  |:....:|.|.  .|.:.:..|.||. |..||...|.|:
Zfish   104 SSNLTIFSMNSGRN-PRVVMAVNI--IQDMLFRYHGM--IGANLILGGVDCT-GSHLYTVGPYGS 162

  Fly   155 YSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSVEEAK 192
            ........:|....|||.:|:    .:..|:..:|:||
Zfish   163 MDKVPYLAMGSGDLAAMGILE----DRFKVNMDLEQAK 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 44/168 (26%)
Ntn_hydrolase 3..218 CDD:294319 44/168 (26%)
psmb13aNP_571752.2 proteasome_beta_type_7 45..233 CDD:239732 42/163 (26%)
Pr_beta_C 241..272 CDD:315191
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.