DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and psmb3

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001123295.1 Gene:psmb3 / 573095 ZFINID:ZDB-GENE-040426-2682 Length:205 Species:Danio rerio


Alignment Length:237 Identity:43/237 - (18%)
Similarity:82/237 - (34%) Gaps:60/237 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GTCVGLLAKNGVLLATERSVD---KLMDTSIPVPRISWLNENIACCATGNTADGNVLVNQLRMIA 93
            |..:.:..|..|.:|::|...   :|:.|..  .:|..:.|.:.....|...|...:..:|:...
Zfish     9 GAVMAMRGKECVAIASDRRFGIQAQLVTTDF--QKIFPMGERLYIGLAGLATDVQTVSQRLKFRL 71

  Fly    94 QQYQFNFGEMIPCE---QLVTNLCDIKQAYTQYGGKRPFGVSFLYMGWDCR-----------FGF 144
            ..|:...|..|...   .:|:||     .|.:..|  |:.:..:..|.|.:           .|.
Zfish    72 NLYELKEGRQIKPRTFMSMVSNL-----LYERRFG--PYYIEPVIAGLDPKTFEPFICSLDLIGC 129

  Fly   145 QLYQSD--PSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSVEEAKDVAIKVMGMTLGRDS 207
            .:...|  .||       ||..:..|....:.:.::        ..|:..:...:.|...:.||:
Zfish   130 PMVTEDFVVSG-------TCSEQMYGMCESLWEPDM--------KPEDLFETISQAMLNAVDRDA 179

  Fly   208 LTPEKLEIAFVQRYGNTTVFHILEKNEIHRLIERNNNLKRRV 249
            ::            |...|.|::||::|     ....||.|:
Zfish   180 VS------------GMGVVVHVIEKDKI-----TTRTLKARM 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 40/227 (18%)
Ntn_hydrolase 3..218 CDD:294319 34/204 (17%)
psmb3NP_001123295.1 PRE1 3..198 CDD:223711 40/229 (17%)
proteasome_beta_type_3 6..201 CDD:239728 40/232 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.