DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and PSMB10

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_002792.1 Gene:PSMB10 / 5699 HGNCID:9538 Length:273 Species:Homo sapiens


Alignment Length:159 Identity:48/159 - (30%)
Similarity:74/159 - (46%) Gaps:26/159 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ASQSGTCV-GLLAKNGVLL-----ATERSV--DKLMDTSIPVPRISWLNENIACCATGNTADGNV 84
            |.::||.: ||:.::||:|     ||..||  ||..:      :|.::...|.||..|..||..:
Human    35 ARKTGTTIAGLVFQDGVILGADTRATNDSVVADKSCE------KIHFIAPKIYCCGAGVAADAEM 93

  Fly    85 LVNQLRMIAQQ---YQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPFGVSFLYMGWDCRFGFQL 146
            ..   ||:|.:   :..:.|.. |....||.:  ::|...:|.|.  .|.|.:..|.|.. |.||
Human    94 TT---RMVASKMELHALSTGRE-PRVATVTRI--LRQTLFRYQGH--VGASLIVGGVDLT-GPQL 149

  Fly   147 YQSDPSGNYSGWKATCIGRKSGAAMEMLQ 175
            |...|.|:||....|.:|....||:.:|:
Human   150 YGVHPHGSYSRLPFTALGSGQDAALAVLE 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 48/159 (30%)
Ntn_hydrolase 3..218 CDD:294319 48/159 (30%)
PSMB10NP_002792.1 proteasome_beta_type_7 40..227 CDD:239732 46/154 (30%)
Pr_beta_C 232..267 CDD:403609
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.