DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and PSMB8

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_683720.2 Gene:PSMB8 / 5696 HGNCID:9545 Length:276 Species:Homo sapiens


Alignment Length:239 Identity:55/239 - (23%)
Similarity:90/239 - (37%) Gaps:49/239 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FFDSRTTIFSPEG-RLYQVEYAMEAASQSGTCVGLLAKNGVLLATE-RSVDKLMDTSIPVPRISW 66
            ||.|    ...:| |..|:|.|     ...|.:....::||:.|.: |:......:::.|.::..
Human    53 FFQS----LGGDGERNVQIEMA-----HGTTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIE 108

  Fly    67 LNENIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMI---PCEQLVTN-LCDIKQAYTQYGGKR 127
            :|..:....:|..||.......|....:.|....||.|   ...:|::| :|       ||.|  
Human   109 INPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMC-------QYRG-- 164

  Fly   128 PFGVSF--LYMGWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGY---VSPS 187
             .|:|.  :..||| :.|..||..|..|..........|..:..|..::     ..||   :|| 
Human   165 -MGLSMGSMICGWD-KKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVM-----DSGYRPNLSP- 221

  Fly   188 VEEAKDVAIKVMGMTLGRDSLTPEKLEIAFVQRYGNTTVFHILE 231
             |||.|:..:.:.....|||.:.           |...::|:.|
Human   222 -EEAYDLGRRAIAYATHRDSYSG-----------GVVNMYHMKE 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 55/239 (23%)
Ntn_hydrolase 3..218 CDD:294319 52/224 (23%)
PSMB8NP_683720.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
proteasome_beta_type_5 73..260 CDD:239730 47/210 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.