Sequence 1: | NP_651843.1 | Gene: | Prosalpha3T / 43679 | FlyBaseID: | FBgn0261395 | Length: | 251 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_002790.1 | Gene: | PSMB7 / 5695 | HGNCID: | 9544 | Length: | 277 | Species: | Homo sapiens |
Alignment Length: | 202 | Identity: | 43/202 - (21%) |
---|---|---|---|
Similarity: | 90/202 - (44%) | Gaps: | 16/202 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 YAMEAASQSGTCV-GLLAKNGVLL-ATERSVDKLMDTSIPVPRISWLNENIACCATGNTADGNVL 85
Fly 86 VNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPFGVSFLYMGWDCRFGFQLYQSD 150
Fly 151 PSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSV--EEAKDVAIKVMGMTLGRDSLTPEKL 213
Fly 214 EIAFVQR 220 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosalpha3T | NP_651843.1 | PTZ00246 | 1..241 | CDD:173491 | 43/202 (21%) |
Ntn_hydrolase | 3..218 | CDD:294319 | 43/198 (22%) | ||
PSMB7 | NP_002790.1 | proteasome_beta_type_7 | 44..232 | CDD:239732 | 41/192 (21%) |
Pr_beta_C | 236..271 | CDD:403609 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |