DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and PSMA7

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_002783.1 Gene:PSMA7 / 5688 HGNCID:9536 Length:248 Species:Homo sapiens


Alignment Length:257 Identity:85/257 - (33%)
Similarity:136/257 - (52%) Gaps:29/257 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FDSRTTIFSPEGRLYQVEYAMEAASQSGTCVGLLAKNGVLLATE-RSVDKLMDTSIPVPRISWLN 68
            :|...|:|||:|.|:|||||.||..:..|.||:..::.|:|..| :||.||.|.. .|.:|..|:
Human     3 YDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDER-TVRKICALD 66

  Fly    69 ENIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPFGVSF 133
            :|:.....|.|||..:::|:.|:..|.::....:.:..|.:...:..:||.|||..|:||||:|.
Human    67 DNVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISA 131

  Fly   134 LYMGWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSVEEAKDVAIKV 198
            |.:|:|.....:|||:||||.|..|||..|||.:.:..|.|:     |.|...:: |..|:.||:
Human   132 LIVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLE-----KNYTDEAI-ETDDLTIKL 190

  Fly   199 MGMTL-------GRDSLTPEKLEIAFVQRYGNTTVFHILEKNEIHRLI-----ERNNNLKRR 248
            :...|       |::      :|:|.::|   .....||...||.:.:     |:..|.|::
Human   191 VIKALLEVVQSGGKN------IELAVMRR---DQSLKILNPEEIEKYVAEIEKEKEENEKKK 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 82/248 (33%)
Ntn_hydrolase 3..218 CDD:294319 77/220 (35%)
PSMA7NP_002783.1 proteasome_alpha_type_7 3..211 CDD:239724 77/220 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.