DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and PSMA6

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_002782.1 Gene:PSMA6 / 5687 HGNCID:9535 Length:246 Species:Homo sapiens


Alignment Length:248 Identity:92/248 - (37%)
Similarity:130/248 - (52%) Gaps:20/248 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FDSRTTIFSPEGRLYQVEYAMEAASQSG-TCVGLLAKNGVLLATERSV-DKLMDTSIPVPRISWL 67
            ||...|||||||||||||||.:|.:|.| |.|.:..|:..::.|::.| |||:|:| .|..:..:
Human     9 FDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSS-TVTHLFKI 72

  Fly    68 NENIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPFGVS 132
            .|||.|..||.|||....|.:.|..|..:::.:|..||.:.|...:.||.|.|||....||.|..
Human    73 TENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCC 137

  Fly   133 FLYMGWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSVEEAKDVAIK 197
            .:.:|.|...|.|:|:.||:|.|.|:|||..|.|...:...|:|::..|  ...:.|:..:.||.
Human   138 MILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKK--FDWTFEQTVETAIT 200

  Fly   198 VMGMTLGRDSLTPEKLEIAFVQRYGNTTV----FHILEKNEIH----RLIERN 242
            .:...|..| ..|.::|:      |..||    |.||.:.||.    .|.||:
Human   201 CLSTVLSID-FKPSEIEV------GVVTVENPKFRILTEAEIDAHLVALAERD 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 90/245 (37%)
Ntn_hydrolase 3..218 CDD:294319 81/214 (38%)
PSMA6NP_002782.1 proteasome_alpha_type_6 8..220 CDD:239723 82/220 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.