DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and psma3

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001025358.1 Gene:psma3 / 564370 ZFINID:ZDB-GENE-050913-120 Length:255 Species:Danio rerio


Alignment Length:229 Identity:76/229 - (33%)
Similarity:110/229 - (48%) Gaps:22/229 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FDSRTTIFSPEGRLYQVEYAMEAASQSGTCVGLLAKNGVLLATERSV-DKLMDTSIPVPRISWLN 68
            :|...:.|||:||::||||||:|...|.|.:|:..|:||:...|:.| .||.:.. ...||..::
Zfish     8 YDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEG-SNKRIFNID 71

  Fly    69 ENIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPFGVSF 133
            .::.....|..||...|....|..|..::.|:|..||.:.|...:.....|||.|...||||.||
Zfish    72 RHVGMAVAGLLADARSLSEVAREEASSFRSNYGHDIPLKHLADRVAMYVHAYTLYSAVRPFGCSF 136

  Fly   134 LYMGWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAA---MEMLQ----------KELFSKGYVS 185
            :...:|...|.|||..||||...|:....||:...||   :|.||          ||:....|:.
Zfish   137 ILGSYDEDDGPQLYMVDPSGIAYGYWGCAIGKAKQAAKTEIEKLQMKDMTCRELVKEVAKIIYIV 201

  Fly   186 PSVEEAKDVAIK-----VMGMTLGRDSLTPEKLE 214
            .  :|.||.|.:     |..:|.||..|.|:.::
Zfish   202 H--DEVKDKAFELELSWVGEVTKGRHELVPKDVK 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 76/229 (33%)
Ntn_hydrolase 3..218 CDD:294319 76/229 (33%)
psma3NP_001025358.1 proteasome_alpha_type_3 5..217 CDD:239720 70/211 (33%)
PRE1 6..241 CDD:223711 76/229 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.