DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and psma2

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001016382.1 Gene:psma2 / 549136 XenbaseID:XB-GENE-964711 Length:234 Species:Xenopus tropicalis


Alignment Length:223 Identity:79/223 - (35%)
Similarity:115/223 - (51%) Gaps:12/223 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RFFDSRTTIFSPEGRLYQVEYAMEAASQSGTCVGLLAKNGVLLATERSVDKLMDTSIPVPRISWL 67
            |.:....|.|||.|:|.|:|||:.|.:.....||:.|.|||:||||:....::.......::..:
 Frog     4 RGYSFSLTTFSPSGKLVQIEYALAAVAAGAPSVGIKATNGVVLATEKKQKSILYDEQSAHKVEPI 68

  Fly    68 NENIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPFGVS 132
            .::|....:|...|..|||.:.|.:||||...:.|.||..|||..:..:.|.|||.||.||||||
 Frog    69 TKHIGMVYSGMGPDYRVLVRRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPFGVS 133

  Fly   133 FLYMGWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSVEEAKDVAIK 197
            .|..|||....: |:||||||.|..||||.:|:........|:|. :::..   .:|:|...|| 
 Frog   134 LLIAGWDEGRPY-LFQSDPSGAYFAWKATAMGKNYVNGKTFLEKR-YNEDL---ELEDAIHTAI- 192

  Fly   198 VMGMTLGRD---SLTPEKLEIAFVQRYG 222
               :||...   .:|.:.:|:......|
 Frog   193 ---LTLKESFEGQMTEDNIEVGICNEAG 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 79/223 (35%)
Ntn_hydrolase 3..218 CDD:294319 78/217 (36%)
psma2NP_001016382.1 proteasome_alpha_type_2 6..231 CDD:239719 78/221 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.