DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and Prosbeta1

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_652031.2 Gene:Prosbeta1 / 46058 FlyBaseID:FBgn0010590 Length:224 Species:Drosophila melanogaster


Alignment Length:262 Identity:55/262 - (20%)
Similarity:91/262 - (34%) Gaps:84/262 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FDSRTTIFSPEGRLYQVEYAMEAASQSGTCVGLLAK--NGVLLATERSVDKLMDTSIPVPRISWL 67
            ||...|..|....:..||:      ..|..:|..::  :|..:| .|..|||          :.:
  Fly     5 FDFTDTPVSTGTTIMAVEF------DGGVVIGADSRTSSGAYVA-NRVTDKL----------TRI 52

  Fly    68 NENIACCATGNTADGNVLVNQLRMIAQQYQFNFGE--------MIPCEQLVTNLCDIKQAYTQYG 124
            .:.:.||.:|:.||...:.:   ::|  |..|:.|        :........|.|        |.
  Fly    53 TDKVYCCRSGSAADTQAIAD---IVA--YSLNYHENQTNKDALVFEAASEFRNYC--------YS 104

  Fly   125 GKRPFGVSFLYMGWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSVE 189
            .:.......:..|||.:.|.|:| |.|.|.....::..|| .||::        |..|:|     
  Fly   105 YRESLLAGIIVAGWDEQRGGQVY-SIPLGGMLTRESCTIG-GSGSS--------FIYGFV----- 154

  Fly   190 EAKDVAIKVMGMTLGRDSLTPE-KLE--IAFVQRYGNTTVFH-----------ILEKNEIHRLIE 240
                           |:...|. .||  :.||::.....::|           |:.|:.|.|.|.
  Fly   155 ---------------REHYRPNMALEDCVTFVKKAVQHAIYHDGSSGGVVRIGIITKDGIERRIF 204

  Fly   241 RN 242
            .|
  Fly   205 YN 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 54/259 (21%)
Ntn_hydrolase 3..218 CDD:294319 46/225 (20%)
Prosbeta1NP_652031.2 20S_bact_beta 15..201 CDD:163402 48/245 (20%)
proteasome_beta_type_6 16..203 CDD:239731 49/246 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441174
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.