DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and ctsv

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001004869.1 Gene:ctsv / 448179 XenbaseID:XB-GENE-966214 Length:335 Species:Xenopus tropicalis


Alignment Length:185 Identity:36/185 - (19%)
Similarity:61/185 - (32%) Gaps:54/185 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 QYQFNFGEMIPCEQLVTNLCDIKQA----------------YTQYGGKRPFGVSFLYMGWD---C 140
            |:..|.|:||...:  .||.|..:|                |.:..|......|:.|...|   |
 Frog   150 QHYRNTGKMISLSE--QNLVDCSRAQGNQGCNGGLMDQAFQYVKDNGGIDSEDSYPYTAKDDQEC 212

  Fly   141 RFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSVE---------------- 189
            .:       ||  ||:....|.....:..:.:.|...:.|.|.||.:|:                
 Frog   213 HY-------DP--NYNSANDTGFVDVTSGSEKDLMNAVASVGPVSVAVDAGHQSFQFYKSGIYYE 268

  Fly   190 -----EAKDVAIKVMGMTLGRDSLTPEKLEI---AFVQRYGNTTVFHILEKNEIH 236
                 |..|..:.|:|.....:....:|..|   ::.:::||....:|.:....|
 Frog   269 PECSSEDLDHGVLVVGYGFEGEDEDGKKYWIVKNSWSEKWGNDGYIYIAKDRHNH 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 36/185 (19%)
Ntn_hydrolase 3..218 CDD:294319 32/165 (19%)
ctsvNP_001004869.1 Inhibitor_I29 29..87 CDD:214853
Peptidase_C1 115..334 CDD:306594 36/185 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.