DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and psmb1

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001003889.1 Gene:psmb1 / 445413 ZFINID:ZDB-GENE-040618-2 Length:237 Species:Danio rerio


Alignment Length:245 Identity:46/245 - (18%)
Similarity:87/245 - (35%) Gaps:59/245 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FSPEGRLYQVEYA-------MEAASQSGTCVGLLAKNGVLLATERSVD--------------KLM 55
            :...|::.:..|.       ...|...||.:.:..::..::|::..:.              ||.
Zfish     7 YGENGKMKEYHYTGPVEHKFSPYAFNGGTVLAVAGEDFAIVASDTRLSEGYSIHSRDSPKCYKLT 71

  Fly    56 DTSIPVPRISWLNENIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAY 120
            ||::           :.|  :|...|...|...:....:.|:.:..:.:....:...|..|..  
Zfish    72 DTTV-----------LGC--SGFHGDCLTLTKIIEARLKMYKHSNNKSMTSGAIAAMLSTILY-- 121

  Fly   121 TQYGGKR--PFGVSFLYMGWDCRFGFQLYQSDPSGNY--SGWKATCIGRKSGAAMEMLQ------ 175
                |:|  |:.|..:..|.|......:|..||.|:|  ..:||      .|:|..|||      
Zfish   122 ----GRRFFPYYVYNIIGGLDEEGRGAVYSFDPVGSYQRDTYKA------GGSASAMLQPLLDNQ 176

  Fly   176 ---KELFSKGYVSPSVEEAKDVAIKVMGMTLGRDSLTPEKLEIAFVQRYG 222
               |.:.:..:|..:.|:|..:...|......||..|.:.|::..|.:.|
Zfish   177 IGFKNMENVEHVPLTQEKAVQLVKDVFISAAERDVYTGDALKVCIVSKEG 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 46/245 (19%)
Ntn_hydrolase 3..218 CDD:294319 44/239 (18%)
psmb1NP_001003889.1 PRE1 22..237 CDD:223711 44/230 (19%)
proteasome_beta_type_1 26..237 CDD:239726 44/226 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.