DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and psmb2

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001002609.1 Gene:psmb2 / 436882 ZFINID:ZDB-GENE-040718-353 Length:199 Species:Danio rerio


Alignment Length:211 Identity:47/211 - (22%)
Similarity:81/211 - (38%) Gaps:35/211 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VGLLAKNGVLLATER-SVDKLMDTSIPVPRISWLNENIACCATGNTADGNVLVNQLRMIAQQYQF 98
            :|:...:.||:|.:. :...::.......::..|:|.|.....|...|.......::...|.|:.
Zfish     5 IGIQGPDFVLVAADNVAASSIIQMKHDYDKMFKLSEKILLLCVGEAGDTVQFAEYIQKNVQLYKM 69

  Fly    99 NFG-EMIPCEQ---LVTNLCDIKQAYTQYGGKRPFGVSFLYMGWDCRFGFQLYQSDPSGNYSGWK 159
            ..| |:.|...   ...||.|..::.|      |:.|:.|..|:|...|..||..|.....:  |
Zfish    70 RNGYELSPAAAANFTRKNLADYLRSRT------PYHVNLLLAGYDETDGPGLYYMDYLSALA--K 126

  Fly   160 ATCIGRKSGA--AMEMLQKELFSKGYVSPSV--EEAKDVAIKVMGMTLGRDSLTPEKLEIAFVQR 220
            |.......||  .:.:|.:      |..|.:  |||.|:..|.:           |:|...|:..
Zfish   127 APFAAHGYGAFLTLSILDR------YYRPDLTREEAVDLLKKCL-----------EELNKRFILN 174

  Fly   221 YGNTTVFHILEKNEIH 236
            ..:.|| .:::|:.||
Zfish   175 LPSFTV-RLIDKDGIH 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 47/211 (22%)
Ntn_hydrolase 3..218 CDD:294319 41/191 (21%)
psmb2NP_001002609.1 proteasome_beta_type_2 1..192 CDD:239727 47/211 (22%)
PRE1 5..188 CDD:223711 45/208 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.