Sequence 1: | NP_651843.1 | Gene: | Prosalpha3T / 43679 | FlyBaseID: | FBgn0261395 | Length: | 251 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001002543.2 | Gene: | psmb10 / 436816 | ZFINID: | ZDB-GENE-040718-278 | Length: | 276 | Species: | Danio rerio |
Alignment Length: | 199 | Identity: | 59/199 - (29%) |
---|---|---|---|
Similarity: | 89/199 - (44%) | Gaps: | 25/199 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 EGRLYQVEYAMEAASQSGTCV-GLLAKNGVLL-ATERSVDKLMDTSIPVPRISWLNENIACCATG 77
Fly 78 NTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPFGVSFLYMGWDCRF 142
Fly 143 GFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPS--VEEAKDVAIKVMGMTLGR 205
Fly 206 DSLT 209 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosalpha3T | NP_651843.1 | PTZ00246 | 1..241 | CDD:173491 | 59/199 (30%) |
Ntn_hydrolase | 3..218 | CDD:294319 | 59/199 (30%) | ||
psmb10 | NP_001002543.2 | PRE1 | 40..224 | CDD:223711 | 55/184 (30%) |
proteasome_beta_type_7 | 43..231 | CDD:239732 | 54/181 (30%) | ||
Pr_beta_C | 237..270 | CDD:289249 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |