DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and Prosalpha4T1

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster


Alignment Length:248 Identity:77/248 - (31%)
Similarity:123/248 - (49%) Gaps:5/248 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARFFDSRTTIFSPEGRLYQVEYAMEAASQSGTCVGLLAKNGVLLATERSVDKLMDTSIPVPRIS 65
            |:..:....|||||:|.|.|||||.||..:..|.||:...|.|:|..|:|....|.....|.:||
  Fly     1 MSSRYGRALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSEMQEDRTVRKIS 65

  Fly    66 WLNENIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPFG 130
            .|:.::|....|.|||..:|:|:.::..|.::.||...:..|.:...|..:||.|||..|:||||
  Fly    66 MLDRHVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFG 130

  Fly   131 VSFLYMGWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSVEEAKDVA 195
            :|.|..|.|.....:|:.::|||.:..:|||..||.:...     :|.|.|.|....|....|..
  Fly   131 ISCLIGGIDADGSARLFHTEPSGIFHEYKATATGRWANTV-----REFFEKAYSDHEVTTKCDAI 190

  Fly   196 IKVMGMTLGRDSLTPEKLEIAFVQRYGNTTVFHILEKNEIHRLIERNNNLKRR 248
            ...|...|....::..:||:|.::......:...:..:||.::::....|:.:
  Fly   191 KLAMRALLEVTQMSQMRLEVAVLENGKPMKMLDSVVISEIVKIVQNEKELQAK 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 76/239 (32%)
Ntn_hydrolase 3..218 CDD:294319 73/214 (34%)
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 75/238 (32%)
proteasome_alpha_type_7 5..213 CDD:239724 73/212 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441093
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.