DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and Prosbeta3

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_649858.1 Gene:Prosbeta3 / 41079 FlyBaseID:FBgn0026380 Length:205 Species:Drosophila melanogaster


Alignment Length:246 Identity:54/246 - (21%)
Similarity:84/246 - (34%) Gaps:63/246 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 MEAASQSGTC-VGLLAKNGVLLATERSVDKLMDT-SIPVPRISWLNENIACCATGNTADGNVLVN 87
            |...:.:|.| |.:..|:.|.:||:........| |....::..:...:....||...|...:.:
  Fly     1 MSILAYNGGCVVAMRGKDCVAIATDHRFGIQAQTISTDFKKVFHIGPRMFLGLTGLQTDILTVRD 65

  Fly    88 QLRMIAQQYQFNFG-EMIPCEQLVTNLCDIKQAYTQYGGKRPFGV---SFLYMGWDCRFGFQLYQ 148
            :|......|:.... ||.|                     :||..   ||||   :.|||  .|.
  Fly    66 RLMFRKNLYETRENREMCP---------------------KPFSAMMSSFLY---EHRFG--PYF 104

  Fly   149 SDPSGNYSGWKATCIGRKSGAAME--MLQKELFSKGYVSPSVEEAKDVAIKVMGM--TLGRDSLT 209
            .:|          .:.......||  :...:|............|...|.::.||  ||.:..|.
  Fly   105 IEP----------VVAGLDPKTMEPFICNMDLIGCPNAPDDFVVAGTCAEQLYGMCETLWKPDLE 159

  Fly   210 PEKLEIAFVQRYGN-----------TTVFHILEKNEIHRLIERNNNLKRRV 249
            |::|.....|...|           .||: |:||::|   .||  .||.|:
  Fly   160 PDQLFEVIAQSIVNAFDRDAMSGWGATVY-IIEKDKI---TER--TLKTRM 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 49/236 (21%)
Ntn_hydrolase 3..218 CDD:294319 41/202 (20%)
Prosbeta3NP_649858.1 proteasome_beta_type_3 6..201 CDD:239728 50/236 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441148
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.