DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and Psma3l

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001004094.1 Gene:Psma3l / 408248 RGDID:1598236 Length:255 Species:Rattus norvegicus


Alignment Length:224 Identity:74/224 - (33%)
Similarity:108/224 - (48%) Gaps:18/224 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FDSRTTIFSPEGRLYQVEYAMEAASQSGTCVGLLAKNGVLLATERSV-DKLMDTSIPVPRISWLN 68
            :|...:.|||:||::||||||:|...|.|.:|:..|:||:...|:.| .||.:.. ...|:..::
  Rat     8 YDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEG-SNKRLFNVD 71

  Fly    69 ENIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPFGVSF 133
            .::.....|..||...|.:..|..|..::.|||..||.:.|...:.....|||.|...||||.||
  Rat    72 RHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSF 136

  Fly   134 LYMGWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAA---MEMLQ-KELFSKGYVSPSV------ 188
            :...:....|.|||..||||...|:....||:...||   :|.|| ||:..:..|....      
  Rat   137 MLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDVVKEVAKIIYIV 201

  Fly   189 -EEAKDVAIK-----VMGMTLGRDSLTPE 211
             :|.||.|.:     |..:|.||..:.|:
  Rat   202 HDEVKDKAFELELSWVGELTKGRHEIVPK 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 74/224 (33%)
Ntn_hydrolase 3..218 CDD:294319 74/224 (33%)
Psma3lNP_001004094.1 proteasome_alpha_type_3 5..217 CDD:239720 69/209 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.