DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and psma8

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_998331.1 Gene:psma8 / 406445 ZFINID:ZDB-GENE-040426-2194 Length:251 Species:Danio rerio


Alignment Length:240 Identity:84/240 - (35%)
Similarity:130/240 - (54%) Gaps:10/240 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARFFDSRTTIFSPEGRLYQVEYAMEAASQSGTCVGLLAKNGVLLATE-RSVDKLMDTSIPVPRI 64
            ||..:|...|:|||:|.|:|||||.||..:..|.||:..|:.|:|..| :||.||.:.. .|.:|
Zfish     1 MAARYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGIRGKDIVVLGVEKKSVAKLQEER-TVRKI 64

  Fly    65 SWLNENIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPF 129
            ..|:|::.....|.|||..:::|:.|:..|.::....:.:..|.:...:..:||.|||..|:|||
Zfish    65 CALDEHVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIATLKQRYTQSNGRRPF 129

  Fly   130 GVSFLYMGWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSVEEAKDV 194
            |:|.|.:|:|.....:|||:||||.|..|||..|||.:....|.|:|....:...|.:  :|..:
Zfish   130 GISALIVGFDYDGTPRLYQTDPSGTYHAWKANAIGRSAKTVREFLEKNYTDEAIASDN--DAIKL 192

  Fly   195 AIKVMGMTLGRDSLTPEKLEIAFVQRYGNTTVFHILEKNEIHRLI 239
            |||.:...:....   :.:|:|.::|   .....|||..||..|:
Zfish   193 AIKALLEVVQSGG---KNIELAVIRR---NQPLKILESKEIETLV 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 84/240 (35%)
Ntn_hydrolase 3..218 CDD:294319 75/215 (35%)
psma8NP_998331.1 proteasome_alpha_type_7 5..213 CDD:239724 75/213 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.