DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and Prosbeta6

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_524115.1 Gene:Prosbeta6 / 39855 FlyBaseID:FBgn0002284 Length:235 Species:Drosophila melanogaster


Alignment Length:251 Identity:52/251 - (20%)
Similarity:98/251 - (39%) Gaps:56/251 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FSPEGRLYQVEYAMEAASQSGTCVGLLAKNGVLLATE-----------RSVDKLMDTSIPVPRIS 65
            |||    |:        |..|:.|.:...:..::|.:           |:..||..         
  Fly    22 FSP----YE--------SNGGSIVAIAGDDFAVIAADTRLSSGYNIHSRTQSKLFK--------- 65

  Fly    66 WLNENIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGK-RPF 129
             |:......:.|..||...|...:::..|.|:......:..|.:...|     :...|..: .|:
  Fly    66 -LSPQTVLGSAGCWADTLSLTGSIKVRMQSYEHTHLRTMTTEAVAQML-----SIAMYNRRFFPY 124

  Fly   130 GVSFLYMGWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSK-GYVSPSVEEAKD 193
            .||.:..|.|......:|..||.|:..  |||.  |..|.|..:||..|.:: |:.:.::|:|..
  Fly   125 YVSNILAGIDNEGKGVVYSYDPIGHCE--KATY--RAGGTAGTLLQPVLDNQIGHKNMNLEDADK 185

  Fly   194 VAI-KVMGMTLGRDSLTPEKLEIAFVQR---YGNTTVFHILEKN--EIHRLIERNN 243
            :.: |...:::..|:.      |:..:|   .|::.:.:|:.|:  |:..|..|.:
  Fly   186 IKLTKERAVSVASDTF------ISAAERDIYTGDSVLINIITKDGIEVRTLTLRQD 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 51/247 (21%)
Ntn_hydrolase 3..218 CDD:294319 45/219 (21%)
Prosbeta6NP_524115.1 proteasome_beta_type_1 22..235 CDD:239726 52/249 (21%)
PRE1 24..225 CDD:223711 47/237 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441182
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.