DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and Prosbeta2

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_524076.2 Gene:Prosbeta2 / 39628 FlyBaseID:FBgn0023174 Length:272 Species:Drosophila melanogaster


Alignment Length:222 Identity:49/222 - (22%)
Similarity:87/222 - (39%) Gaps:36/222 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TCVGLLAKNGVLL-ATERSVDKLMDTSIPVPRISWLNENIACCATGNTADGNVLVNQLRMIAQQY 96
            |.||::.|:||:| |..|:.:..:.:.....:|.:|.:||.||..|..||..:..:   :|:.|.
  Fly    41 TIVGIIYKDGVILGADTRATEGPIVSDKNCAKIHYLAKNIYCCGAGTAADTEMTTD---LISSQL 102

  Fly    97 QFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPFGVSFLYMGWDCRFGFQLYQSDPSGNYSGWKAT 161
            :.:..:.....::|.....:||...:|.|...   :.|.:|...:.|..:|...|.|:.......
  Fly   103 ELHRLQTDREVRVVAANTMLKQMLFRYQGHIS---AALVLGGVDKTGPHIYSIHPHGSSDKLPYA 164

  Fly   162 CIGRKSGAAMEMLQKELFSKGYVSPSVEEAKDV--------AIKVMGMTLGRDSLTPEKLEIAFV 218
            .:|..|.|||.:.:    |:.....|.||.|.:        ....:|.....|.....|..:.::
  Fly   165 TMGSGSLAAMTVFE----SRWKPDLSEEEGKKLVRDAIASGVFNDLGSGSNIDLCVIRKGSVEYL 225

  Fly   219 QRY-----------------GNTTVFH 228
            :.|                 |.:||.|
  Fly   226 RNYELANKKGKRQLDYRFKTGTSTVLH 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 49/222 (22%)
Ntn_hydrolase 3..218 CDD:294319 44/193 (23%)
Prosbeta2NP_524076.2 PRE1 42..232 CDD:223711 44/199 (22%)
proteasome_beta_type_7 42..228 CDD:239732 43/195 (22%)
Pr_beta_C 232..264 CDD:289249 4/21 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441180
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.