DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and Prosalpha4T2

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster


Alignment Length:255 Identity:86/255 - (33%)
Similarity:134/255 - (52%) Gaps:14/255 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARFFDSRTTIFSPEGRLYQVEYAMEAASQSGTCVGLLAKNGVLLATE-RSVDKLMDTSIPVPRI 64
            ||:.:|...||:||:|.|.|||||.||..:..|.:||...|.:::..| |||..|.:..: |.:|
  Fly     1 MAQRYDRAVTIYSPDGHLLQVEYAQEAVRRGSTVMGLRTNNAIVIGVEKRSVGDLQEERM-VRKI 64

  Fly    65 SWLNENIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPF 129
            ..|::::....:|.|||..:||::.:|.||.::.||.:....|.:...:..:||.|||..|:|||
  Fly    65 CMLDDHVVMTFSGLTADARILVSRAQMEAQSHRLNFEKPTTVEYITRYIAQLKQNYTQSNGRRPF 129

  Fly   130 GVSFLYMGWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSVEEAKDV 194
            |:|.|..|:|......|:|:||||.:..|:|...||.|....:.::|.   ...:....:||  .
  Fly   130 GLSCLVGGFDEDGTPHLFQTDPSGIFYEWRANTTGRSSQPVRDYMEKH---ADEILTIADEA--A 189

  Fly   195 AIKVMGMTL-GRDSLTPEKLEIAFVQ-----RYGNTTVFHILEKNEIHRLIERNNNLKRR 248
            |||.:..|| ...||...::|:|.::     |..:..|...||:. :.|.||......||
  Fly   190 AIKHIVRTLVSVSSLNHTQMEVAVLKYRQPLRMIDHQVLADLERT-VRREIEDEAEASRR 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 83/246 (34%)
Ntn_hydrolase 3..218 CDD:294319 75/216 (35%)
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 75/215 (35%)
Ntn_hydrolase 5..214 CDD:294319 75/214 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441089
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.